McDonnell Genome Institute

Washington University

Transcript

lnc-SFSWAP-2:2

Chromosome

chr12

Gene Name

lnc-SFSWAP-2

Start

131456926

CPC Label

coding

End

131466989

Cancer

BRCA-Luminal B

Strand

+

Peptide

MLAGAHR

Modified Peptide

n[145]MLAGAHR

Peptide Length

7

ORF Length

103

Open Reading Frame (ORF)

LGITRMLAGDYPDAGWGSPGCWLGITRMLAGAHRCTRASMNTRQNQAASGLLRTSFLHTEAAVGPASPETPALGSASTTHPAPAQGWSRRLLSWPLSCLPAPI

Conservation Score

0.949

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.534454

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.330620512