McDonnell Genome Institute

Washington University

Transcript

lnc-SFSWAP-2:1

Chromosome

chr12

Gene Name

lnc-SFSWAP-2

Start

131457032

CPC Label

noncoding

End

131458888

Cancer

OSCC

Strand

+

Peptide

MLGEIPTFVFEK

Modified Peptide

n[145]MLGEIPTFVFEK

Peptide Length

12

ORF Length

47

Open Reading Frame (ORF)

MLGEIPTFVFEKHQSVLFVILKHSKTNCQFAVCISNLLSVYLISWLL

Conservation Score

0.191

PhyloCSF Frame 1

-5.231

No. of Spectra

3

CPC Coding Probability

0.0681636

PhyloCSF Frame 2 

-4.823

CNTI Index

noncoding

Max Probability

0.7816

PhyloCSF Frame 3

-5.095

CNTI Score

-0.349743074