McDonnell Genome Institute

Washington University

Transcript

lnc-SFRP4-3:1

Chromosome

chr7

Gene Name

lnc-SFRP4-3

Start

37762924

CPC Label

noncoding

End

37826933

Cancer

OV

Strand

-

Peptide

TLWEAEEGGSLEAR

Modified Peptide

n[145]TLWEAEEGGSLEAR

Peptide Length

14

ORF Length

68

Open Reading Frame (ORF)

MRVIRTLWEAEEGGSLEARSPRLAWPHVKTPSLLKIQTNKQTSCLVPFMFHNFIIWFALLKLWQENKY

Conservation Score

0.186

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.108453

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8115

PhyloCSF Frame 3

0

CNTI Score

0.617477853