McDonnell Genome Institute

Washington University

Transcript

lnc-SFPQ-3:1

Chromosome

chr1

Gene Name

lnc-SFPQ-3

Start

35143181

CPC Label

noncoding

End

35143496

Cancer

OV

Strand

-

Peptide

KQMQALKIAIQSVH

Modified Peptide

n[145]KQMQALKIAIQSVH

Peptide Length

14

ORF Length

85

Open Reading Frame (ORF)

MNWTLEQLLKKILPGNSCKIKSGFCLWSSSESGAPPNKQGICPIRFCSVGHPQIIGQIKGDLQKLQELTLKKQMQALKIAIQSVH

Conservation Score

0.674

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.119577

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9307

PhyloCSF Frame 3

0

CNTI Score

-0.385384177