McDonnell Genome Institute

Washington University

Transcript

lnc-SFPQ-1:1

Chromosome

chr1

Gene Name

lnc-SFPQ-1

Start

35141361

CPC Label

noncoding

End

35146397

Cancer

OV

Strand

-

Peptide

RDQAAAEDDSPALVTPEADQSTHGR

Modified Peptide

n[145]RDQAAAEDDSPALVTPEADQSTHGR

Peptide Length

25

ORF Length

84

Open Reading Frame (ORF)

LIALIQSLELSEVAGVVSWIHHSQLTLAAQDKWTSQQDADHPTWLILRRDQAAAEDDSPALVTPEADQSTHGRSLRTHRASKCS

Conservation Score

0.227

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0183017

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6217

PhyloCSF Frame 3

0

CNTI Score

-0.325790225