McDonnell Genome Institute

Washington University

Transcript

lnc-SF3B1-2:1

Chromosome

chr2

Gene Name

lnc-SF3B1-2

Start

197379700

CPC Label

noncoding

End

197380892

Cancer

OSCC

Strand

-

Peptide

NCFWMTEQEAIQDFWQWR

Modified Peptide

n[145]NCFWMTEQEAIQDFWQWR

Peptide Length

18

ORF Length

92

Open Reading Frame (ORF)

MHKSQIRMEKTQNHHQHQDQKDKNPSKNRKKLLKHLKGPSSVEDIKAKMQASIEKCGSLPKVEAKFISYVKNCFWMTEQEAIQDFWQWRKSL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.294458

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6734

PhyloCSF Frame 3

0

CNTI Score

0.688509891