McDonnell Genome Institute

Washington University

Transcript

lnc-SETD9-6:1

Chromosome

chr5

Gene Name

lnc-SETD9-6

Start

57190723

CPC Label

noncoding

End

57193689

Cancer

BRCA-Basal-like

Strand

+

Peptide

LGVTYMSITK

Modified Peptide

n[145]LGVTYMSITK

Peptide Length

10

ORF Length

56

Open Reading Frame (ORF)

LRQENRLNLGGGGCGELRSRHCTPVWATRAELRLKKKKKKKLGVTYMSITKANVLC

Conservation Score

0.193

PhyloCSF Frame 1

0

No. of Spectra

45

CPC Coding Probability

0.019014

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.330042185