McDonnell Genome Institute

Washington University

Transcript

lnc-SETD7-6:1

Chromosome

chr4

Gene Name

lnc-SETD7-6

Start

139976625

CPC Label

noncoding

End

139978779

Cancer

OV

Strand

-

Peptide

LTAFLNNAICR

Modified Peptide

n[145]LTAFLNNAICR

Peptide Length

11

ORF Length

34

Open Reading Frame (ORF)

LTAFLNNAICRAPLFHSLVLCEGHTWTKMVIALS

Conservation Score

0.949

PhyloCSF Frame 1

-5.431

No. of Spectra

1

CPC Coding Probability

0.13396

PhyloCSF Frame 2 

-5.08

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-4.716

CNTI Score

-0.356576416