McDonnell Genome Institute

Washington University

Transcript

lnc-SETD7-3:22

Chromosome

chr4

Gene Name

lnc-SETD7-3

Start

139397243

CPC Label

noncoding

End

139453745

Cancer

PRAD

Strand

-

Peptide

LSSSNPLASAFQSVGITGISHQGWPR

Modified Peptide

‚Äč

Peptide Length

26

ORF Length

78

Open Reading Frame (ORF)

LSSSNPLASAFQSVGITGISHQGWPRQCFQLPSIFFHPWVISSNSHFYILPGTNALNSLLSLSFSYIHYPNHNSGSVL

Conservation Score

0.685

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0911939

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.3492377