McDonnell Genome Institute

Washington University

Transcript

lnc-SETD6-13:1

Chromosome

chr16

Gene Name

lnc-SETD6-13

Start

59655601

CPC Label

noncoding

End

59656336

Cancer

BRCA-Luminal B

Strand

+

Peptide

NLGIHSQASK

Modified Peptide

n[145]NLGIHSQASK

Peptide Length

10

ORF Length

66

Open Reading Frame (ORF)

LGLSPENNLLKNLKNLGIHSQASKFLFKIKDLDFMSRKKGMIRPENKEKARDKISKVGLRFRSYAR

Conservation Score

0.081

PhyloCSF Frame 1

-5.691

No. of Spectra

22

CPC Coding Probability

0.0172018

PhyloCSF Frame 2 

-4.272

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-5.187

CNTI Score

-0.362064273