McDonnell Genome Institute

Washington University

Transcript

lnc-SETD1B-2:2

Chromosome

chr12

Gene Name

lnc-SETD1B-2

Start

121800796

CPC Label

coding

End

121803403

Cancer

BRCA-Luminal A

Strand

+

Peptide

GAAEGAANASSR

Modified Peptide

n[145]GAAEGAANASSR

Peptide Length

12

ORF Length

90

Open Reading Frame (ORF)

LPRPAALLQPITYPRPNYKPRKEPQYELHQLRAPARRLLRLGRQRGAAEGAANASSRSPGASELNSQNGSRALIGRRHSRTFNKERGRKR

Conservation Score

1

PhyloCSF Frame 1

-1.273

No. of Spectra

8

CPC Coding Probability

0.551185

PhyloCSF Frame 2 

5.145

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0.458

CNTI Score

-0.286708134