McDonnell Genome Institute

Washington University

Transcript

lnc-SETBP1-8:1

Chromosome

chr18

Gene Name

lnc-SETBP1-8

Start

42081873

CPC Label

noncoding

End

42083384

Cancer

OV

Strand

+

Peptide

ALSSECSLHISLLSLPCDFFGDK

Modified Peptide

n[145]ALSSECSLHISLLSLPCDFFGDK

Peptide Length

23

ORF Length

72

Open Reading Frame (ORF)

LAVSDKPISKRKVAYQSQFLLLKAILYSYFFQIPLFLLFRALSSECSLHISLLSLPCDFFGDKFSDISSMMF

Conservation Score

0.162

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0528833

PhyloCSF Frame 2 

-4.346

CNTI Index

noncoding

Max Probability

0.5351

PhyloCSF Frame 3

-4.067

CNTI Score

-0.491898147