McDonnell Genome Institute

Washington University

Transcript

lnc-SERTM2-8:1

Chromosome

chrX

Gene Name

lnc-SERTM2-8

Start

111096324

CPC Label

noncoding

End

111098786

Cancer

BRCA-Luminal B

Strand

+

Peptide

RAVCMIPVR

Modified Peptide

n[145]RAVCM[147]IPVR

Peptide Length

9

ORF Length

68

Open Reading Frame (ORF)

LTGWLDPWQPRVSYVAPRSPETKRAVCMIPVRGQVGVSGPFPEGRGSFAWSNPRLVYWGLGRLRQNPP

Conservation Score

1

PhyloCSF Frame 1

-1.314

No. of Spectra

2

CPC Coding Probability

0.0220834

PhyloCSF Frame 2 

-1.806

CNTI Index

noncoding

Max Probability

0.9473

PhyloCSF Frame 3

-1.562

CNTI Score

-0.307540638