McDonnell Genome Institute

Washington University

Transcript

lnc-SERTM2-4:1

Chromosome

chrX

Gene Name

lnc-SERTM2-4

Start

111010920

CPC Label

noncoding

End

111015857

Cancer

BRCA-Luminal B

Strand

+

Peptide

LTTSCLFMLCQLR

Modified Peptide

n[145]LTTSCLFMLCQLR

Peptide Length

13

ORF Length

33

Open Reading Frame (ORF)

LTTSCLFMLCQLRDPLTRLYVYPLKCFKHLSLC

Conservation Score

0.261

PhyloCSF Frame 1

-4.292

No. of Spectra

20

CPC Coding Probability

0.0289499

PhyloCSF Frame 2 

-4.473

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-5.631

CNTI Score

-0.39953932