McDonnell Genome Institute

Washington University

Transcript

lnc-SERTM2-3:1

Chromosome

chrX

Gene Name

lnc-SERTM2-3

Start

111434426

CPC Label

noncoding

End

111435024

Cancer

HCC

Strand

+

Peptide

KAVGAEK

Modified Peptide

n[230]KAVGAEK

Peptide Length

7

ORF Length

74

Open Reading Frame (ORF)

LGEMWNNTAADNKQPCERKAAKLKEKYDKDIVVHGAKGKPDAAKKKAVGAEKSKKKNEEEKDEEDDVEEEDDHE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.210914

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8097

PhyloCSF Frame 3

0

CNTI Score

0.680136857