McDonnell Genome Institute

Washington University

Transcript

lnc-SERTM2-2:1

Chromosome

chrX

Gene Name

lnc-SERTM2-2

Start

111398328

CPC Label

noncoding

End

111409053

Cancer

OSCC

Strand

+

Peptide

LALTDPEFQPNLSPK

Modified Peptide

n[145]LALTDPEFQPNLSPK

Peptide Length

15

ORF Length

33

Open Reading Frame (ORF)

MVSSRSYRLALTDPEFQPNLSPKTSVFIIICCL

Conservation Score

0.961

PhyloCSF Frame 1

-6.642

No. of Spectra

5

CPC Coding Probability

0.055554

PhyloCSF Frame 2 

-5.051

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-4.773

CNTI Score

-0.327722848