McDonnell Genome Institute

Washington University

Transcript

lnc-SERTAD2-3:11

Chromosome

chr2

Gene Name

lnc-SERTAD2-3

Start

64762117

CPC Label

noncoding

End

64863626

Cancer

CCRC

Strand

-

Peptide

FSDMCVSSLIGK

Modified Peptide

n[230]FSDMCVSSLIGK

Peptide Length

12

ORF Length

63

Open Reading Frame (ORF)

MRPDWRTLKSDVCWDNGAQAEEIFISCTSAVPCCPTSPEFWLSYNVRRFSDMCVSSLIGKWGC

Conservation Score

0.983

PhyloCSF Frame 1

-4.251

No. of Spectra

6

CPC Coding Probability

0.0769592

PhyloCSF Frame 2 

-3.817

CNTI Index

noncoding

Max Probability

0.6649

PhyloCSF Frame 3

-4.904

CNTI Score

-0.381551623