McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINI1-20:1

Chromosome

chr3

Gene Name

lnc-SERPINI1-20

Start

165933938

CPC Label

noncoding

End

166170563

Cancer

EOGC

Strand

+

Peptide

ENFRPVSLMNNDAK

Modified Peptide

n[145]ENFRPVSLMNNDAK

Peptide Length

14

ORF Length

84

Open Reading Frame (ORF)

LTIKSPEPDGFTAKFYQRYKEKLVPFLLKLFQSIEKEGILPNSVYGASIILIPKLGRDTTKKENFRPVSLMNNDAKILSKILAN

Conservation Score

0.453

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.103274

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.379689013