McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINI1-19:1

Chromosome

chr3

Gene Name

lnc-SERPINI1-19

Start

166293755

CPC Label

noncoding

End

166294353

Cancer

HCC

Strand

+

Peptide

AAQPGSAK

Modified Peptide

n[230]AAQPGSAK

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LFEKEVLKKIIEDQQESLNKWSSKGRRLKGKGKHNKAAQPGSAKRKLHFLSK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0258288

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9621

PhyloCSF Frame 3

0

CNTI Score

-0.38341547