McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINI1-17:4

Chromosome

chr3

Gene Name

lnc-SERPINI1-17

Start

168249940

CPC Label

noncoding

End

168821335

Cancer

OV

Strand

+

Peptide

VLWEELQK

Modified Peptide

n[145]VLWEELQK

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

MEESARKERVNAPAQQVAVSFFVMKVSLIFSSFVLSPSRMPKRVLWEELQKEM

Conservation Score

1

PhyloCSF Frame 1

-3.94

No. of Spectra

1

CPC Coding Probability

0.252787

PhyloCSF Frame 2 

-3.589

CNTI Index

coding

Max Probability

0.866

PhyloCSF Frame 3

-5.641

CNTI Score

0.629675163