McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINH1-3:3

Chromosome

chr11

Gene Name

lnc-SERPINH1-3

Start

75526061

CPC Label

noncoding

End

75531062

Cancer

HCC

Strand

+

Peptide

MFGIYLEDIGALARR

Modified Peptide

n[43]M[147]FGIYLEDIGALARR

Peptide Length

15

ORF Length

64

Open Reading Frame (ORF)

MFGIYLEDIGALARRECEGEWEAWLGPSLLCPLTHIQRASLGPPPACPSCSLVFHCPQWPCGLN

Conservation Score

0.429

PhyloCSF Frame 1

-5.896

No. of Spectra

1

CPC Coding Probability

0.163101

PhyloCSF Frame 2 

-4.431

CNTI Index

noncoding

Max Probability

0.7793

PhyloCSF Frame 3

-4.111

CNTI Score

-0.304599129