McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB6-4:1

Chromosome

chr6

Gene Name

lnc-SERPINB6-4

Start

2940063

CPC Label

noncoding

End

2956475

Cancer

BRCA-Luminal A

Strand

-

Peptide

GIVSNHPGIMVSFPFPR

Modified Peptide

n[145]GIVSNHPGIM[147]VSFPFPR

Peptide Length

17

ORF Length

38

Open Reading Frame (ORF)

LGLQGMGAGSGVRGIVSNHPGIMVSFPFPRIRMVSLVS

Conservation Score

0.06

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.112999

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.39952279