McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB6-1:13

Chromosome

chr6

Gene Name

lnc-SERPINB6-1

Start

2989344

CPC Label

noncoding

End

2999579

Cancer

HCC

Strand

-

Peptide

LTFAELK

Modified Peptide

n[230]LTFAELK

Peptide Length

7

ORF Length

105

Open Reading Frame (ORF)

LHCLTHSLSVSCIGLTTQQETTLFGITGTPGNISIYTYLNVCKGVWGRKKQHISFFAFYNTGLLEFVTHVNICNIFKLNCMYYRTVLCAELGLKVERLTFAELKK

Conservation Score

0.531

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0404955

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

0

CNTI Score

-0.385456011