McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB3-8:1

Chromosome

chr18

Gene Name

lnc-SERPINB3-8

Start

63966405

CPC Label

noncoding

End

63970181

Cancer

OV

Strand

-

Peptide

FMFQLLTYFFK

Modified Peptide

n[145]FMFQLLTYFFK

Peptide Length

11

ORF Length

52

Open Reading Frame (ORF)

MIFLYDLHYIHRFMFQLLTYFFKISNLSRAVDVTCVLLDISQKPGCVPPQFF

Conservation Score

0.171

PhyloCSF Frame 1

-4.817

No. of Spectra

3

CPC Coding Probability

0.0308329

PhyloCSF Frame 2 

-5.698

CNTI Index

noncoding

Max Probability

0.9875

PhyloCSF Frame 3

-4.21

CNTI Score

-0.392604354