McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB2-1:1

Chromosome

chr18

Gene Name

lnc-SERPINB2-1

Start

63869679

CPC Label

noncoding

End

63870818

Cancer

OV

Strand

+

Peptide

ALAPNGNMLNVAGAR

Modified Peptide

n[145]ALAPNGNMLNVAGAR

Peptide Length

15

ORF Length

35

Open Reading Frame (ORF)

MALAPNGNMLNVAGARQQQSRQRHIDKAPTVSTIP

Conservation Score

0.332

PhyloCSF Frame 1

-3.909

No. of Spectra

1

CPC Coding Probability

0.0213853

PhyloCSF Frame 2 

-5.407

CNTI Index

noncoding

Max Probability

0.6182

PhyloCSF Frame 3

-3.783

CNTI Score

-0.355087114