McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB1-2:4

Chromosome

chr6

Gene Name

lnc-SERPINB1-2

Start

2843398

CPC Label

noncoding

End

2843610

Cancer

OSCC

Strand

-

Peptide

LLVLDSHPCPR

Modified Peptide

n[145]LLVLDSHPCPR

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

MSMCRRKPDAIYQDNGRMNPKAFLRLLVLDSHPCPRVPGP

Conservation Score

0.406

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.0212578

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6955

PhyloCSF Frame 3

0

CNTI Score

-0.504163627