McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINB1-1:8

Chromosome

chr6

Gene Name

lnc-SERPINB1-1

Start

2783342

CPC Label

noncoding

End

2799965

Cancer

OSCC

Strand

-

Peptide

DVVEGGSPEVR

Modified Peptide

n[145]DVVEGGSPEVR

Peptide Length

11

ORF Length

52

Open Reading Frame (ORF)

MEVQGVAAMSQDWKPGLSAKPCSLHSLCPLVRDVVEGGSPEVRSLRPAWPTR

Conservation Score

0.341

PhyloCSF Frame 1

-3.172

No. of Spectra

7

CPC Coding Probability

0.0335192

PhyloCSF Frame 2 

-5.268

CNTI Index

noncoding

Max Probability

0.9349

PhyloCSF Frame 3

-4.936

CNTI Score

-0.315218818