McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINA3-3:2

Chromosome

chr14

Gene Name

lnc-SERPINA3-3

Start

94643332

CPC Label

coding

End

94652058

Cancer

HCC

Strand

+

Peptide

WSNMAGLHTPQMPTGSLGEAR

Modified Peptide

n[230]WSNM[147]AGLHTPQMPTGSLGEAR

Peptide Length

21

ORF Length

61

Open Reading Frame (ORF)

LLEKISPNQAWHPCPPWPCAWGVGGLLGGGGREKWSNMAGLHTPQMPTGSLGEARWVTREP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.728655

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5609

PhyloCSF Frame 3

0

CNTI Score

-0.321912553