McDonnell Genome Institute

Washington University

Transcript

lnc-SERPINA12-3:1

Chromosome

chr14

Gene Name

lnc-SERPINA12-3

Start

94602664

CPC Label

noncoding

End

94604625

Cancer

OSCC

Strand

-

Peptide

LVPSGEAGAIQR

Modified Peptide

n[145]LVPSGEAGAIQR

Peptide Length

12

ORF Length

40

Open Reading Frame (ORF)

LVPSGEAGAIQRVSPTRASFATWLCHIYLLGDFRAITLPL

Conservation Score

0.502

PhyloCSF Frame 1

-3.977

No. of Spectra

6

CPC Coding Probability

0.174918

PhyloCSF Frame 2 

-4.136

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

-4.161

CNTI Score

-0.367049478