McDonnell Genome Institute

Washington University

Transcript

lnc-SERP2-15:1

Chromosome

chr13

Gene Name

lnc-SERP2-15

Start

44306701

CPC Label

noncoding

End

44307196

Cancer

OSCC

Strand

+

Peptide

AACCPGFLIK

Modified Peptide

n[145]AACCPGFLIK

Peptide Length

10

ORF Length

76

Open Reading Frame (ORF)

LPAVGKSALRRAACCPGFLIKEEDRTPNLRGGPMSGPRERKKVLKRRKRPASFSCTHTHTKKKRKKGRKEEKERKK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0373267

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.961

PhyloCSF Frame 3

0

CNTI Score

-0.389897533