McDonnell Genome Institute

Washington University

Transcript

lnc-SERP1-4:7

Chromosome

chr3

Gene Name

lnc-SERP1-4

Start

150353300

CPC Label

noncoding

End

150408092

Cancer

OV

Strand

-

Peptide

LHCDDSIIK

Modified Peptide

n[145]LHCDDSIIK

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LFISLVFHQYNGSTLQGKKTSARPTKTHIFKKDKLHCDDSIIKLLKDVLHQNEDMKPI

Conservation Score

0.998

PhyloCSF Frame 1

-5.726

No. of Spectra

4

CPC Coding Probability

0.122971

PhyloCSF Frame 2 

-5.129

CNTI Index

noncoding

Max Probability

0.5647

PhyloCSF Frame 3

-4.771

CNTI Score

-0.347804867