McDonnell Genome Institute

Washington University

Transcript

lnc-SERP1-4:1

Chromosome

chr3

Gene Name

lnc-SERP1-4

Start

150408101

CPC Label

noncoding

End

150409679

Cancer

OV

Strand

-

Peptide

AGGPPSPALAGAQPQGHVDCLRR

Modified Peptide

n[145]AGGPPSPALAGAQPQGHVDCLRR

Peptide Length

23

ORF Length

116

Open Reading Frame (ORF)

LREGAASPESEMPNSAGSRGPELAEGPRAGGGAVARAGGPPSPALAGAQPQGHVDCLRRKPALGEGKAGSVLPLQGEPPLRAGGDGGLGLPSRLLSERGGGGRPLARDRRRPGCVR

Conservation Score

1

PhyloCSF Frame 1

0.468

No. of Spectra

2

CPC Coding Probability

0.202594

PhyloCSF Frame 2 

0.968

CNTI Index

noncoding

Max Probability

0.8866

PhyloCSF Frame 3

-0.494

CNTI Score

-0.255237018