McDonnell Genome Institute

Washington University

Transcript

lnc-SERP1-2:1

Chromosome

chr3

Gene Name

lnc-SERP1-2

Start

150611261

CPC Label

noncoding

End

150611877

Cancer

OSCC

Strand

-

Peptide

RMVSGAVGQQATPASAR

Modified Peptide

n[145]RM[147]VSGAVGQQATPASAR

Peptide Length

17

ORF Length

83

Open Reading Frame (ORF)

MNGFTPGQWGGGSRSGRCGRQCLVREIGAEGPGAGAVSAAGPLGAARPGSWQLCCLRRMVSGAVGQQATPASARGSRRAYPRR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.393897

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9601

PhyloCSF Frame 3

0

CNTI Score

-0.318980051