McDonnell Genome Institute

Washington University

Transcript

lnc-SERINC3-4:1

Chromosome

chr20

Gene Name

lnc-SERINC3-4

Start

44466563

CPC Label

noncoding

End

44466842

Cancer

HCC

Strand

-

Peptide

YGASLWK

Modified Peptide

n[230]YGASLWK

Peptide Length

7

ORF Length

49

Open Reading Frame (ORF)

MAKPTKKVGIVGKYGTRYGASLWKMVKKVEISQQAKYTCSFCGKTKMKR

Conservation Score

1

PhyloCSF Frame 1

-3.297

No. of Spectra

1

CPC Coding Probability

0.038496

PhyloCSF Frame 2 

-4.256

CNTI Index

noncoding

Max Probability

0.6102

PhyloCSF Frame 3

-4.6

CNTI Score

-0.346057184