McDonnell Genome Institute

Washington University

Transcript

lnc-SERINC2-2:1

Chromosome

chr1

Gene Name

lnc-SERINC2-2

Start

31444184

CPC Label

noncoding

End

31449455

Cancer

OV

Strand

+

Peptide

ILANQEEMMVAWMR

Modified Peptide

n[145]ILANQEEMMVAWMR

Peptide Length

14

ORF Length

80

Open Reading Frame (ORF)

MFFHIDPALLTEKTIPSLPQENCHQSEMLTLDALWTMDWWRSGSRGMCRRILANQEEMMVAWMRVVVVEEEDGGEINRAW

Conservation Score

0.574

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.127329

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5144

PhyloCSF Frame 3

0

CNTI Score

-0.387397338