McDonnell Genome Institute

Washington University

Transcript

lnc-SERINC1-3:1

Chromosome

chr6

Gene Name

lnc-SERINC1-3

Start

122436788

CPC Label

noncoding

End

122439223

Cancer

OV

Strand

-

Peptide

YFVLVLFQ

Modified Peptide

n[145]YFVLVLFQ

Peptide Length

8

ORF Length

74

Open Reading Frame (ORF)

LKLFRSCGITCLSSISLSKILVVICVFCQFSNELFIISSHFQISTAFIKFSFFHSLFVSSCSILPKYFVLVLFQ

Conservation Score

0.381

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0579194

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5682

PhyloCSF Frame 3

0

CNTI Score

-0.344580032