McDonnell Genome Institute

Washington University

Transcript

lnc-SERHL2-2:2

Chromosome

chr22

Gene Name

lnc-SERHL2-2

Start

42444751

CPC Label

noncoding

End

42450766

Cancer

OV

Strand

+

Peptide

VGGFSELR

Modified Peptide

n[145]VGGFSELR

Peptide Length

8

ORF Length

94

Open Reading Frame (ORF)

LNQILGTSWLQQVDTKNEPLQKTKNSHQLPPMQLAHLLGCPPQQVAQESLPWQGGGLGCVQVPMGSFFAMGKARVTPCLNTRVGGFSELRLRYC

Conservation Score

0.089

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.309845

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7747

PhyloCSF Frame 3

0

CNTI Score

-0.327302673