McDonnell Genome Institute

Washington University

Transcript

lnc-SERHL2-1:6

Chromosome

chr22

Gene Name

lnc-SERHL2-1

Start

42508361

CPC Label

noncoding

End

42512504

Cancer

OV

Strand

+

Peptide

GQREVQPMDWERGVEGPHLSPK

Modified Peptide

n[145]GQREVQPMDWERGVEGPHLSPK

Peptide Length

22

ORF Length

63

Open Reading Frame (ORF)

LAGAITECPSCTVVPASFFLLARSLSQAGRGQREVQPMDWERGVEGPHLSPKIQAQKWPNSLL

Conservation Score

0.039

PhyloCSF Frame 1

-3.062

No. of Spectra

3

CPC Coding Probability

0.0694868

PhyloCSF Frame 2 

-3.777

CNTI Index

noncoding

Max Probability

0.7634

PhyloCSF Frame 3

-3.427

CNTI Score

-0.329443504