McDonnell Genome Institute

Washington University

Transcript

lnc-SERHL2-1:14

Chromosome

chr22

Gene Name

lnc-SERHL2-1

Start

42500603

CPC Label

noncoding

End

42502653

Cancer

OV

Strand

+

Peptide

LAGQCQLLR

Modified Peptide

n[145]LAGQCQLLR

Peptide Length

9

ORF Length

93

Open Reading Frame (ORF)

MNEGMKDPAVSFRSDLRAEAGCALGPHRSQSLGLPAGPSSSLPARLAGQCQLLRQTHPSSPARLLLRCHGFRRSWALVPLQPRCPILPPDFCE

Conservation Score

1

PhyloCSF Frame 1

-4.36

No. of Spectra

1

CPC Coding Probability

0.09156

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8573

PhyloCSF Frame 3

9.202

CNTI Score

-0.304766061