McDonnell Genome Institute

Washington University

Transcript

lnc-SERHL2-1:11

Chromosome

chr22

Gene Name

lnc-SERHL2-1

Start

42500567

CPC Label

coding

End

42512402

Cancer

OV

Strand

+

Peptide

MFLSLQAENSIDFVSR

Modified Peptide

n[145]MFLSLQAENSIDFVSR

Peptide Length

16

ORF Length

92

Open Reading Frame (ORF)

MFLSLQAENSIDFVSRELCAHSIRKLQAHVLLIKAVHGYFDPRENYSDKESLSFMIDTMKSTLKEDYFGYNHSNPGLGPALSLPCNFTTQLA

Conservation Score

1

PhyloCSF Frame 1

-3.684

No. of Spectra

1

CPC Coding Probability

0.998969

PhyloCSF Frame 2 

7.82

CNTI Index

coding

Max Probability

0.6775

PhyloCSF Frame 3

-1.195

CNTI Score

0.746375095