McDonnell Genome Institute

Washington University

Transcript

lnc-SERF1A-2:2

Chromosome

chr5

Gene Name

lnc-SERF1A-2

Start

70751126

CPC Label

coding

End

70791362

Cancer

EOGC

Strand

+

Peptide

VWSGNACKASPGK

Modified Peptide

n[145]VWSGNACKASPGK

Peptide Length

13

ORF Length

90

Open Reading Frame (ORF)

MVIAHTKALDPSQPVTFVTNSTYAADKGALYVDVIRVNSYYSWYRNYGHLELIQLQLAAQFENWCKTSQSHYSERVWSGNACKASPGKRC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.953883

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9525

PhyloCSF Frame 3

0

CNTI Score

0.668297175