McDonnell Genome Institute

Washington University

Transcript

lnc-SERAC1-8:1

Chromosome

chr6

Gene Name

lnc-SERAC1-8

Start

158237335

CPC Label

coding

End

158237917

Cancer

BRCA-Basal-like

Strand

-

Peptide

HQRPAGAPATK

Modified Peptide

n[145]HQRPAGAPATK

Peptide Length

11

ORF Length

184

Open Reading Frame (ORF)

LAQFISAYSLADPEKGTALSKHLPSSDSMSLKVDVEALENSPGATYIWKGGKVTRDSQPKEQGKGDLKKKKKGKLPKNYDPKLTPDPERWLPMQECSFYQGRKKGKKKDQMGKGTQGATAGASSELDARKTVSSPPTSPRPGSAATLSASTSNIIPPRHQRPAGAPATKKKQQQKKKKGGKGGW

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.892945

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

0

CNTI Score

-0.320744009