McDonnell Genome Institute

Washington University

Transcript

lnc-SERAC1-7:1

Chromosome

chr6

Gene Name

lnc-SERAC1-7

Start

158055726

CPC Label

noncoding

End

158057565

Cancer

BRCA-Luminal A

Strand

-

Peptide

QEFFGILR

Modified Peptide

n[145]QEFFGILR

Peptide Length

8

ORF Length

73

Open Reading Frame (ORF)

LSIEAFFSLPLPTGYCHRKLLGKQEFFGILRNQISIWKHPSHLQGGTKSSAHPDVHSSRPQSGAGKEKGFTVL

Conservation Score

0.081

PhyloCSF Frame 1

-3.322

No. of Spectra

3

CPC Coding Probability

0.080238

PhyloCSF Frame 2 

-4.135

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-2.567

CNTI Score

-0.346858831