McDonnell Genome Institute

Washington University

Transcript

lnc-SERAC1-3:2

Chromosome

chr6

Gene Name

lnc-SERAC1-3

Start

157872570

CPC Label

noncoding

End

157875210

Cancer

OV

Strand

-

Peptide

SLYELMWVAR

Modified Peptide

n[145]SLYELM[147]WVAR

Peptide Length

10

ORF Length

61

Open Reading Frame (ORF)

LNVKRWDAHPRPGICPLPPRWSTESSGNPPGNPEPCLKGFCTLQLTLLAPKSLYELMWVAR

Conservation Score

0.072

PhyloCSF Frame 1

-2.968

No. of Spectra

1

CPC Coding Probability

0.0097549

PhyloCSF Frame 2 

-3.114

CNTI Index

noncoding

Max Probability

0.9925

PhyloCSF Frame 3

-2.688

CNTI Score

-0.432546421