McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT9-2:1

Chromosome

chr17

Gene Name

lnc-SEPT9-2

Start

77528124

CPC Label

coding

End

77536591

Cancer

CCRC

Strand

+

Peptide

TALSCCARR

Modified Peptide

n[230]TALSCCARR

Peptide Length

9

ORF Length

131

Open Reading Frame (ORF)

MPPTPSRGRQGRGGRNLEATCDARSCVLCPGAWVRERRAASRTALSCCARRCSSFPSSAPSPRDPPPASSVLEASQDGVGAWRERGEEGAARGQCRQEVGRGLWRPSRLLRAGWGPCTALRARRCIFWNGS

Conservation Score

0.198

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.583624

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9941

PhyloCSF Frame 3

0

CNTI Score

-0.305920106