McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT7-5:1

Chromosome

chr7

Gene Name

lnc-SEPT7-5

Start

35313854

CPC Label

coding

End

35376476

Cancer

CCRC

Strand

+

Peptide

QLSGASFYK

Modified Peptide

n[230]QLSGASFYK

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LLCLHLAEETRQLSGASFYKATSPIYEGSTLMT

Conservation Score

0.138

PhyloCSF Frame 1

-5.721

No. of Spectra

4

CPC Coding Probability

0.534523

PhyloCSF Frame 2 

-4.598

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-5.567

CNTI Score

-0.380608178