McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT7-1:8

Chromosome

chr7

Gene Name

lnc-SEPT7-1

Start

35715033

CPC Label

noncoding

End

35719695

Cancer

OV

Strand

+

Peptide

AMLGFDSGILVEAMMR

Modified Peptide

n[145]AMLGFDSGILVEAM[147]M[147]R

Peptide Length

16

ORF Length

36

Open Reading Frame (ORF)

LAAAEQDRPDWPVQQQRAMLGFDSGILVEAMMREKR

Conservation Score

0.959

PhyloCSF Frame 1

-5.553

No. of Spectra

15

CPC Coding Probability

0.0462386

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9397

PhyloCSF Frame 3

0

CNTI Score

-0.394890606