McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT7-1:7

Chromosome

chr7

Gene Name

lnc-SEPT7-1

Start

35731730

CPC Label

noncoding

End

35734611

Cancer

OSCC

Strand

+

Peptide

MEIVLMPQAK

Modified Peptide

n[145]MEIVLM[147]PQAK

Peptide Length

10

ORF Length

39

Open Reading Frame (ORF)

MEIVLMPQAKRLYPSHPQEKSLRVFQMIPERMIRQGIRG

Conservation Score

0.379

PhyloCSF Frame 1

-3.906

No. of Spectra

1

CPC Coding Probability

0.0380829

PhyloCSF Frame 2 

-4.692

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

-6.079

CNTI Score

-0.399370836