McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT14-5:1

Chromosome

chr7

Gene Name

lnc-SEPT14-5

Start

55682774

CPC Label

noncoding

End

55713252

Cancer

BRCA-Luminal A

Strand

-

Peptide

QAVGVGSLPK

Modified Peptide

n[145]QAVGVGSLPK

Peptide Length

10

ORF Length

160

Open Reading Frame (ORF)

LEYSVIRLCNWSSPRKRQAVGVGSLPKAIPELALFWVPPRWNLGKTYSIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLA

Conservation Score

1

PhyloCSF Frame 1

10.714

No. of Spectra

1

CPC Coding Probability

0.448041

PhyloCSF Frame 2 

13.398

CNTI Index

coding

Max Probability

0.6731

PhyloCSF Frame 3

0

CNTI Score

0.694315949