McDonnell Genome Institute

Washington University

Transcript

lnc-SEPT14-1:1

Chromosome

chr7

Gene Name

lnc-SEPT14-1

Start

55876737

CPC Label

noncoding

End

55877024

Cancer

EOGC

Strand

-

Peptide

LLPLSYPQTDVFLVCFSVVSPSSFENVK

Modified Peptide

n[145]LLPLSYPQTDVFLVCFSVVSPSSFENVK

Peptide Length

28

ORF Length

52

Open Reading Frame (ORF)

MIGGEPYTLGLFDTAGQEDYDRLLPLSYPQTDVFLVCFSVVSPSSFENVKEK

Conservation Score

1

PhyloCSF Frame 1

-4.512

No. of Spectra

2

CPC Coding Probability

0.0364226

PhyloCSF Frame 2 

-3.34

CNTI Index

noncoding

Max Probability

0.3891

PhyloCSF Frame 3

0

CNTI Score

-0.481297936